Total number of results for Ictalurus punctatus are 7
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02345 |
HSEGTFSNDYSKYLETRRAQDFVQWLMNS
|
29 | Ictalurus punctatus | Glucagon | Glucagon | 3030323#Hoosein N.M., Mahrenholz A.M., Andrews P.C., Gurd R.S.#Biological activities of catfish glucagon and glucagon-like peptide.# Biochem. Biophys. Res. Commun. 143:87-92(1987).$3838546#Andrews P.C., Ronner P.#Isolation and structures of glucagon and glucagon-like peptide from catfish pancreas.#J. Biol. Chem. 260:3910-3914(1985). | |
| NP02346 |
HADGTYTSDVSSYLQEQAAKDFITWLKSGQPKPE
|
34 | Ictalurus punctatus | Glucagon | Glucagon-like peptide | 3030323#Hoosein N.M., Mahrenholz A.M., Andrews P.C., Gurd R.S.#Biological activities of catfish glucagon and glucagon-like peptide.# Biochem. Biophys. Res. Commun. 143:87-92(1987).$3838546#Andrews P.C., Ronner P.#Isolation and structures of glucagon and glucagon-like peptide from catfish pancreas.#J. Biol. Chem. 260:3910-3914(1985). | |
| NP03888 |
SNTDVLTPDLLFGEAEIRLQSRYDDPLMG
|
29 | Ictalurus punctatus | NPY | C-flanking peptide of NPY | ||
| NP03889 |
YPTKPENPGEDAPVEELAKYYSALRHYINLITRQRY
|
36 | Ictalurus punctatus | NPY | Neuropeptide Y | ||
| NP05364 |
DNTVRSKPLNCMNYFWKSSTAC
|
22 | Ictalurus punctatus | Somastostatin | Somatostatin I | 7358665#Oyama H, Bradshaw RA, Bates OJ, Permutt A#Amino acid sequence of catfish pancreatic somatostatin I#J Biol Chem 1980 Mar 25;255(6):2251-4 | |
| NP05391 |
AGCKNFFWKTFTSC
|
14 | Ictalurus punctatus | Somastostatin | Somatostatin-14 | 6114953#Andrews P.C., Dixon J.E.#Isolation and structure of a peptide hormone predicted from a mRNA sequence. A second somatostatin from the catfish pancreas.# J. Biol. Chem. 256:8267-8270(1981). | |
| NP05448 |
VNLNDLLDRASQLSDKMHSLSTSLTNDLDSHFSSVGGKLMRPSMCHTSSLQIPNDKDQALSVPEGELLSLVRSLLMAWSDPLALLSSEATSLPHPERNSINTKTRELQDHTNSLGAGLERLGRKMGSSPESLSSLPFNSNDLGQDNISRLVNFHFLLSCFRRDSHKIDSFLKVLRCDAAKMLPEMC
|
186 | Ictalurus punctatus | Somatotropin/prolactin | Prolactin |